PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s937331g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 455aa    MW: 49014.9 Da    PI: 7.8454
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s937331g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.62.9e-25171215145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+ep+rCrRtDGKkWRCsr++ +++k+CErH+hrgr rsrk++e 
  PDK_30s937331g001 171 DPEPWRCRRTDGKKWRCSRNAAPDQKYCERHMHRGRPRSRKPVEV 215
                        79****************************************985 PP

2QLQ32.33.2e-12109139232
                QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                        ++T aQ q+  +Q+l+yK++++++PvP++Ll
  PDK_30s937331g001 109 PLTSAQRQEIQRQALIYKHIISSVPVPSDLL 139
                        79***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF088801.9E-7109139IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166615.147109144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.215171215IPR014977WRC domain
PfamPF088793.8E-21172214IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
METRVGLGDK KKRTRGDGER PGLGFGRGSD YIPYAPQKLI RTAGLPFLSS CTSGDGSSVP  60
TSTLSFSGSP TLFLNDDYDG GRALLPFPTP FKSPGVGMGV GGCDLRGFPL TSAQRQEIQR  120
QALIYKHIIS SVPVPSDLLI SNSPPYHLPP NLVAGRGGGG TFNLRFSNRM DPEPWRCRRT  180
DGKKWRCSRN AAPDQKYCER HMHRGRPRSR KPVEVSNTKP TSTNAPPTTA VPTNSPTIVT  240
TTTTTASLSR PLPSQSSGLF LKDELKIPFQ SLEPNEEQRC LDWMKGNNEE MESSLQWELM  300
HSKIGLTHGT IPVLQHYEDQ LTMNYAAFLN PDLCSLEENA VGNRGEAPRS FIDAGSTETP  360
AATAEVGNST SVPTTGELPL STLTLSMPST GEGTDHQIQM APVSPLGGPL GEVLQTSSAT  420
SPRQGFGAND GDSSSRGLIN ILSHGFHGSH EKTIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008777916.10.0PREDICTED: growth-regulating factor 2-like, partial
STRINGVIT_16s0098g01080.t018e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2255846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-36growth-regulating factor 2